Commit 636ff4db authored by Hugo Devillers's avatar Hugo Devillers
Browse files

Build feature hierarchy.

parent 82a7d605
......@@ -3,6 +3,20 @@
This document summerizes the cumulative changes in genome annoations
since the initial annotation retieved from the EBI.
## v1.1 (2021-05-18)
### Edited
* Build feature hierarchy.
### Fixed
* Locus tag issue: YALIA101_S06E08900T.
* Bad mRNA and gene coordinates: YALIA101_S01E12200G.
* Bad mRNA and gene coordinates: YALIA101_S01E29712G.
* Too large frameshift: YALIA101_S01E18778G
* Bad mRNA and gene coordinates: YALIA101_S04E08284G.
## v1.0 (2021-05-18)
### Added
......
ID LT576309; SV 1; linear; genomic DNA; CON; FUN; 37116 BP.
ID LT576309; SV 1; linear; genomic DNA; STD; FUN; 37116 BP.
XX
AC LT576309;
XX
PR Project:PRJEB14097;
XX
DT 19-JUN-2016 (Rel. 129, Created)
DT 28-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
......@@ -14,13 +12,13 @@ XX
OS Yarrowia lipolytica
OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC Saccharomycetales; Dipodascaceae; Yarrowia.
OX NCBI_TaxID=4952
XX
RN [1]
RA Devillers H.;
RT ;
RL Submitted (20-MAY-2016) to the INSDC.
RL INRA UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850,
RL France
RL Submitted (20-MAY-2016) to the INSDC. INRA UMR 1319, Institut Micalis,
RL Bat. CBAI, Thiverval-Grignon, 78850, France
XX
DR MD5; 8b10759e83f587145b068c4893574fb9.
DR ENA; FLLM01000000; SET.
......@@ -31,69 +29,75 @@ XX
FH Key Location/Qualifiers
FH
FT source 1..37116
FT /organism="Yarrowia lipolytica"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:4952"
FT /mol_type="genomic DNA"
FT /organism="Yarrowia lipolytica"
FT assembly_gap 659..758
FT /estimated_length=unknown
FT /estimated_length="unknown"
FT /gap_type="within scaffold"
FT /linkage_evidence="paired-ends"
FT assembly_gap 1415..1514
FT /estimated_length=unknown
FT /estimated_length="unknown"
FT /gap_type="within scaffold"
FT /linkage_evidence="paired-ends"
FT gene 5123..5878
FT /locus_tag="YALIA101_S18E00100G"
FT mRNA 5123..5878
FT /locus_tag="YALIA101_S18E00100G"
FT /standard_name="YALIA101S18e00100g1"
FT /product="YALIA101S18e00100g1_1"
FT /standard_name="YALIA101S18e00100g1"
FT CDS 5123..5878
FT /transl_table=1
FT /locus_tag="YALIA101_S18E00100G"
FT /standard_name="YALIA101S18e00100g1_1"
FT /protein_id="SEI37021.1"
FT /standard_name="YALIA101S18e00100g1_1"
FT /transl_table=1
FT /translation="MSTIEDLKATVERLAARVHELEASAKSKIAPEVPKSIRMVLIGPP
FT GAGKGTQAPNLVEKYCACHLATGDMLRSQVQQQTPLGVEAKKIMDAGGLVSDDIMVNMI
FT RSELENNSKCKNGFILDGFPRTIPQAEKLDEMLAEKKQPLEKAVELKIPDDLLVARITG
FT RLVHPASGRSYHKVFNPPKKEMIDDITGEALVQRSDDNADALKKRLVSFHKQTEPIVGY
FT YQKTGIWKGVDAAQDPKKVWGDILKCLGQ"
FT assembly_gap 6103..6202
FT /estimated_length=unknown
FT /estimated_length="unknown"
FT /gap_type="within scaffold"
FT /linkage_evidence="paired-ends"
FT assembly_gap 13639..13738
FT /estimated_length=unknown
FT /estimated_length="unknown"
FT /gap_type="within scaffold"
FT /linkage_evidence="paired-ends"
FT gene 14119..14622
FT /locus_tag="YALIA101_S18E00122G"
FT mRNA 14119..14622
FT /locus_tag="YALIA101_S18E00122G"
FT /standard_name="YALIA101S18e00122g1"
FT /product="YALIA101S18e00122g1_1"
FT /standard_name="YALIA101S18e00122g1"
FT CDS 14119..14622
FT /transl_table=1
FT /locus_tag="YALIA101_S18E00122G"
FT /standard_name="YALIA101S18e00122g1_1"
FT /protein_id="SEI37022.1"
FT /standard_name="YALIA101S18e00122g1_1"
FT /transl_table=1
FT /translation="MSSRSTSALSRNLISHAQESKVEISTHMKFLRKMRPRTSSRQRFL
FT LLILDCPEVKKDVEGDEVESKDDAKESQTEDVMGAVMELNDTEENSISVEKKTKEASEK
FT ESRKESKTGDVAVEEVNSESQHVNNDIVPGRADAEPVKVEPRPENANEVIAEGGQGGGE
FT ERQG"
FT assembly_gap 17750..17849
FT /estimated_length=unknown
FT /estimated_length="unknown"
FT /gap_type="within scaffold"
FT /linkage_evidence="paired-ends"
FT assembly_gap 21815..21914
FT /estimated_length=unknown
FT /estimated_length="unknown"
FT /gap_type="within scaffold"
FT /linkage_evidence="paired-ends"
FT gene complement(23861..24919)
FT /locus_tag="YALIA101_S18E00144G"
FT mRNA complement(23861..24919)
FT /locus_tag="YALIA101_S18E00144G"
FT /standard_name="YALIA101S18e00144g1"
FT /product="YALIA101S18e00144g1_1"
FT /standard_name="YALIA101S18e00144g1"
FT CDS complement(23861..24919)
FT /transl_table=1
FT /locus_tag="YALIA101_S18E00144G"
FT /standard_name="YALIA101S18e00144g1_1"
FT /protein_id="SEI37023.1"
FT /standard_name="YALIA101S18e00144g1_1"
FT /transl_table=1
FT /translation="MLALQDRQPYYSGSAGQPRSDYSYNLVPKDRESVIGAAQVPAQAP
FT VAAHEYQQDNYYYSSRPQSKSLNSSAPSINHSSPQHSQVNTSPSLPSIYDPNGPVAAAY
FT YSGPNSGVNSANHSAVHSQAHSAVHSQVPSQVPSQVPSQVPSQAPSQAGSAPMSPNRLP
......@@ -101,27 +105,31 @@ FT MPVRNSPPQYQSPTANNPYAVGVGSGQLLNQPFNQPMTQQQLQMQQLQLQQQQIQQIQQ
FT LQQQQIQQIQQLQQQQVQQQQFQAQAAQQNQAQYYGQQVPQQMMQMGYQQQMHPHSHLM
FT NQFSSKRQFRTLKKHVCTVCGKRFTRPSSLQTHTYSHTGEKPFRCEFSGCGRQFSVVSN
FT LRRHQKIHSPRE"
FT gene 25695..26159
FT /locus_tag="YALIA101_S18E00166G"
FT mRNA 25695..26159
FT /locus_tag="YALIA101_S18E00166G"
FT /standard_name="YALIA101S18e00166g1"
FT /product="YALIA101S18e00166g1_1"
FT /standard_name="YALIA101S18e00166g1"
FT CDS 25695..26159
FT /transl_table=1
FT /locus_tag="YALIA101_S18E00166G"
FT /standard_name="YALIA101S18e00166g1_1"
FT /protein_id="SEI37024.1"
FT /standard_name="YALIA101S18e00166g1_1"
FT /transl_table=1
FT /translation="MKISPEPYTADLYKLVRKNMKGMYEGSGMGWNRVDKIDEMEDEEL
FT AYHVARENGEMLGFVSFMHTVEDDVEVVYLYELQVAKGRQGHGVGKELMRVVIDEARAC
FT GRPIMLTVFLMNERAIGFYRRYGFERVGRGPQEGKRVRGWMQMRRDTRSD"
FT gene 34384..36099
FT /locus_tag="YALIA101_S18E00188G"
FT mRNA 34384..36099
FT /locus_tag="YALIA101_S18E00188G"
FT /standard_name="YALIA101S18e00188g1"
FT /product="YALIA101S18e00188g1_1"
FT /standard_name="YALIA101S18e00188g1"
FT CDS 34384..36099
FT /transl_table=1
FT /locus_tag="YALIA101_S18E00188G"
FT /standard_name="YALIA101S18e00188g1_1"
FT /protein_id="SEI37025.1"
FT /standard_name="YALIA101S18e00188g1_1"
FT /transl_table=1
FT /translation="MSIYVANLPGSVSEADLFELFKPHGPLKVIKIPRDPKLRTPLGHA
FT YVTFYNPDHADAALGALKETELGGQQVTCALTEEVPSSASSMSTPPSSAHSPIDPARAV
FT FVRDTRDGVDAATTKTALESLGAVSLQPKGPNAFVAVFPTAEEASKVLSDELANLEISP
......
This diff is collapsed.
This source diff could not be displayed because it is too large. You can view the blob instead.
ID LT576312; SV 1; linear; genomic DNA; CON; FUN; 9766 BP.
ID LT576312; SV 1; linear; genomic DNA; STD; FUN; 9766 BP.
XX
AC LT576312;
XX
PR Project:PRJEB14097;
XX
DT 19-JUN-2016 (Rel. 129, Created)
DT 28-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
......@@ -14,13 +12,13 @@ XX
OS Yarrowia lipolytica
OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC Saccharomycetales; Dipodascaceae; Yarrowia.
OX NCBI_TaxID=4952
XX
RN [1]
RA Devillers H.;
RT ;
RL Submitted (20-MAY-2016) to the INSDC.
RL INRA UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850,
RL France
RL Submitted (20-MAY-2016) to the INSDC. INRA UMR 1319, Institut Micalis,
RL Bat. CBAI, Thiverval-Grignon, 78850, France
XX
DR MD5; ed3aaf18dfc2db6b79de0c57c95881c3.
DR ENA; FLLM01000000; SET.
......@@ -30,31 +28,35 @@ XX
FH Key Location/Qualifiers
FH
FT source 1..9766
FT /organism="Yarrowia lipolytica"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:4952"
FT /mol_type="genomic DNA"
FT /organism="Yarrowia lipolytica"
FT gene 241..795
FT /locus_tag="YALIA101_S22E00100G"
FT mRNA 241..795
FT /locus_tag="YALIA101_S22E00100G"
FT /standard_name="YALIA101S22e00100g1"
FT /product="YALIA101S22e00100g1_1"
FT /standard_name="YALIA101S22e00100g1"
FT CDS 241..795
FT /transl_table=1
FT /locus_tag="YALIA101_S22E00100G"
FT /standard_name="YALIA101S22e00100g1_1"
FT /protein_id="SEI37036.1"
FT /standard_name="YALIA101S22e00100g1_1"
FT /transl_table=1
FT /translation="MTRYSVQSVDPTKTASARGAYLRTSFKNTYEVAGAIRGWNLQKAL
FT AYLDQVTDHKRAIPFRKHAGSIGRTGQGKEFGVTKARWPVKSIKFVQDLLQNAQANAET
FT KGLDKETLVISHIQVNQAPKQRRRTYRAHGRINAYQSSPSHIELILSEPAEEIAKAKET
FT SLAHISSRQRGRIAAQKRISA"
FT gene complement(6523..7656)
FT /locus_tag="YALIA101_S22E00122G"
FT mRNA complement(6523..7656)
FT /locus_tag="YALIA101_S22E00122G"
FT /standard_name="YALIA101S22e00122g1"
FT /product="YALIA101S22e00122g1_1"
FT /standard_name="YALIA101S22e00122g1"
FT CDS complement(6523..7656)
FT /transl_table=1
FT /locus_tag="YALIA101_S22E00122G"
FT /standard_name="YALIA101S22e00122g1_1"
FT /protein_id="SEI37037.1"
FT /standard_name="YALIA101S22e00122g1_1"
FT /transl_table=1
FT /translation="MSLPDIDSIPPGSTVPLDQLSSMFATLSTNNGLDLGQLSGLLAQE
FT STQGGSSPTSVVVAASPTSEAPAANTPEASPSNNNNNGGLGPSQSLVDNGPGFQSSLQA
FT LLGTSVTLEVPTAGSNTGNASPSASNGGSDGGDSGSSPSATITGSPTGGSGGSNTGPGF
......@@ -62,11 +64,13 @@ FT TLPTFPAVTLSDSPSAPSNTGGFQLGNIFDGLFGTNSIAIPQSWSELFVKTVDWNTLYH
FT GSPGTIDSSGNIIPMPTATGSDLPAPVVTGSVITLVASPIPTSSGASSSSGGGILGWIG
FT GLFGGDSSSTQAPVATAPVVTNTGVTVVTGTAVVTVTSCSESPCPGSPTTAAPSPSTIL
FT PPNNGGVPTTTGPSQANGAGNLQVVVPLLAVPLLALL"
FT gene 9670..9761
FT /locus_tag="YALIA101_S22E00144R"
FT tRNA join(9670..9707,9726..9761)
FT /locus_tag="YALIA101_S22E00144R"
FT /standard_name="YALIA101S22e00144r1"
FT /note="transfer RNA Asn (anticodon: GTT); Annotated by
FT tRNAscan-SE (cove score: 67.19)"
FT /standard_name="YALIA101S22e00144r1"
XX
SQ Sequence 9766 BP; 2527 A; 2242 C; 2426 G; 2571 T; 0 other;
ttatttccat ttttaatgcc attttaattc cactttttac ttctatttta tttatttatt 60
......
ID LT576313; SV 1; linear; genomic DNA; CON; FUN; 7367 BP.
ID LT576313; SV 1; linear; genomic DNA; STD; FUN; 7367 BP.
XX
AC LT576313;
XX
PR Project:PRJEB14097;
XX
DT 19-JUN-2016 (Rel. 129, Created)
DT 28-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
......@@ -14,13 +12,13 @@ XX
OS Yarrowia lipolytica
OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC Saccharomycetales; Dipodascaceae; Yarrowia.
OX NCBI_TaxID=4952
XX
RN [1]
RA Devillers H.;
RT ;
RL Submitted (20-MAY-2016) to the INSDC.
RL INRA UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850,
RL France
RL Submitted (20-MAY-2016) to the INSDC. INRA UMR 1319, Institut Micalis,
RL Bat. CBAI, Thiverval-Grignon, 78850, France
XX
DR MD5; 5cb61fa3fcee7639e145411f8de41846.
DR ENA; FLLM01000000; SET.
......@@ -30,18 +28,20 @@ XX
FH Key Location/Qualifiers
FH
FT source 1..7367
FT /organism="Yarrowia lipolytica"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:4952"
FT /mol_type="genomic DNA"
FT /organism="Yarrowia lipolytica"
FT gene 1080..2165
FT /locus_tag="YALIA101_S26E00100G"
FT mRNA 1080..2165
FT /locus_tag="YALIA101_S26E00100G"
FT /standard_name="YALIA101S26e00100g1"
FT /product="YALIA101S26e00100g1_1"
FT /standard_name="YALIA101S26e00100g1"
FT CDS 1080..2165
FT /transl_table=1
FT /locus_tag="YALIA101_S26E00100G"
FT /standard_name="YALIA101S26e00100g1_1"
FT /protein_id="SEI37040.1"
FT /standard_name="YALIA101S26e00100g1_1"
FT /transl_table=1
FT /translation="MNRIKAPGGAPNIHTHFVLLRSRAFSSTQKCMDYPAHDNPSPYEI
FT FGMGPHNLNQKALKREYYILAKKYHPDSNGSSEETADLTKEIKDARFRKISNAYEILKN
FT PSRRHAYDRFGQGWEGARPGPYGQDGATSNLYNQASTATAGHGPRYSTQSDGFWGASGW
......@@ -49,15 +49,17 @@ FT QDYEDLRNHSSKAKQNENTTLIGMALVVVAVVVTYLQIKRIIDVMEDQYFRVKEQNKKL
FT EDSLFWARNNYGFAQGKDDRVSRFLVMRRNSLAEEGDYMEAQLSEDNWRRRKIAEKRAK
FT QAEAAAAAASNGEEVHGKLDATPEPPVRPPPTALEVVNAFSKSELISKAVSLTTKDQVV
FT STTSAVFTDSLLTSIQGVDKE"
FT gene 4104..6734
FT /locus_tag="YALIA101_S26E00122G"
FT mRNA 4104..6734
FT /locus_tag="YALIA101_S26E00122G"
FT /standard_name="YALIA101S26e00122g1"
FT /product="YALIA101S26e00122g1_1"
FT /standard_name="YALIA101S26e00122g1"
FT CDS 4104..6734
FT /transl_table=1
FT /locus_tag="YALIA101_S26E00122G"
FT /standard_name="YALIA101S26e00122g1_1"
FT /protein_id="SEI37041.1"
FT /standard_name="YALIA101S26e00122g1_1"
FT /transl_table=1
FT /translation="MTDIKPVDLDTKEYDIDTADVREITLHTEEWIAQKLLIPPSDVDG
FT TYPRSVTVISQAFENMSEAEAIAIVKKAWDQHSSDANLTAEHKDVLQHLIEMIGEGKEG
FT EDESVPPEDLEELKYQACLFHHWSPYQQVRSVTTPFDDQDEECETFRCYVIGIIWVGIA
......
ID LT576314; SV 1; linear; genomic DNA; CON; FUN; 10228 BP.
ID LT576314; SV 1; linear; genomic DNA; STD; FUN; 10228 BP.
XX
AC LT576314;
XX
PR Project:PRJEB14097;
XX
DT 19-JUN-2016 (Rel. 129, Created)
DT 28-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
......@@ -14,13 +12,13 @@ XX
OS Yarrowia lipolytica
OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC Saccharomycetales; Dipodascaceae; Yarrowia.
OX NCBI_TaxID=4952
XX
RN [1]
RA Devillers H.;
RT ;
RL Submitted (20-MAY-2016) to the INSDC.
RL INRA UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850,
RL France
RL Submitted (20-MAY-2016) to the INSDC. INRA UMR 1319, Institut Micalis,
RL Bat. CBAI, Thiverval-Grignon, 78850, France
XX
DR MD5; 861cfc091456eb0559cd3bcea5ae93d8.
DR ENA; FLLM01000000; SET.
......@@ -30,18 +28,20 @@ XX
FH Key Location/Qualifiers
FH
FT source 1..10228
FT /organism="Yarrowia lipolytica"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:4952"
FT /mol_type="genomic DNA"
FT /organism="Yarrowia lipolytica"
FT gene complement(960..2720)
FT /locus_tag="YALIA101_S21E00100G"
FT mRNA complement(960..2720)
FT /locus_tag="YALIA101_S21E00100G"
FT /standard_name="YALIA101S21e00100g1"
FT /product="YALIA101S21e00100g1_1"
FT /standard_name="YALIA101S21e00100g1"
FT CDS complement(960..2720)
FT /transl_table=1
FT /locus_tag="YALIA101_S21E00100G"
FT /standard_name="YALIA101S21e00100g1_1"
FT /protein_id="SEI37033.1"
FT /standard_name="YALIA101S21e00100g1_1"
FT /transl_table=1
FT /translation="METEKTFTTTTVDSDPDTHGEVVVNTKKMNAWQRFKDGFGPADVS
FT HIDTEGLTPMEIAALKTANAPLNRGLKGRHLQMIAIGGSIGTGLFVGSGASLATGGPAA
FT LLIAYGIIGCMLLCTVHALGELAVAFPVSGAFSTYFTRFIDPAWGFAMGWNYTLLWFAI
......@@ -53,15 +53,17 @@ FT YIDKNGRPIYGIFAVLAFGLFAFIAAASADIRNKVFMWLLALSGLSSILVWGSINLAHI
FT RFRQALKFRGRDTSELTFVAGFGVWGSVFGLTLNCLVLVAQFWIALYPIGGEPNAEAFF
FT AAYLAAPIVIVFWIFWKVWKRPPFLKVSDLDIDTGRRDTDLDRVRAETTAEREYIASRN
FT FFYRVYKFWC"
FT gene complement(5864..7453)
FT /locus_tag="YALIA101_S21E00122G"
FT mRNA complement(5864..7453)
FT /locus_tag="YALIA101_S21E00122G"
FT /standard_name="YALIA101S21e00122g1"
FT /product="YALIA101S21e00122g1_1"
FT /standard_name="YALIA101S21e00122g1"
FT CDS complement(5864..7453)
FT /transl_table=1
FT /locus_tag="YALIA101_S21E00122G"
FT /standard_name="YALIA101S21e00122g1_1"
FT /protein_id="SEI37034.1"
FT /standard_name="YALIA101S21e00122g1_1"
FT /transl_table=1
FT /translation="MPITVSQEVTETAPEVSWAATKTYLGSRVSTLKPPKLSAQEKRCL
FT NPIYVLRQLGKKQWLFFSVAILGWIWDAFDYFSVSQTATEIAKDLDMSVADITWGLSIV
FT LMLRSIGAIIFGLASDRFGRKWPFIVNIAIFSILELGTGFVQTYTQFLALRALFGIAMG
......@@ -72,15 +74,17 @@ FT GALSGQVTIGHLSNVFGRRLSVIISCVIGGALIYPWAFSGGGAGINASVFFLQFFVGCW
FT GIVPIHLSELTPPALRTSLVGVAYQLGNLASAASSTIEAKIGERFPILDEHGNHLPEEY
FT DYGKVMAIFMGCVFAFTMIVMFLGPEKRGSDLCAPQYEVTDAQTAAGDEKFEDKEKVEE
FT VAIERIDTNLTR"
FT gene complement(8654..9682)
FT /locus_tag="YALIA101_S21E00144G"
FT mRNA complement(8654..9682)
FT /locus_tag="YALIA101_S21E00144G"
FT /standard_name="YALIA101S21e00144g1"
FT /product="YALIA101S21e00144g1_1"
FT /standard_name="YALIA101S21e00144g1"
FT CDS complement(8654..9682)
FT /transl_table=1
FT /locus_tag="YALIA101_S21E00144G"
FT /standard_name="YALIA101S21e00144g1_1"
FT /protein_id="SEI37035.1"
FT /standard_name="YALIA101S21e00144g1_1"
FT /transl_table=1
FT /translation="MSYTISAAALYSATIYLLFLRDRSRQSLERSEILAAREATNYSIS
FT NTTIFSGVTAKSYGFNAHYRGVPATYWSWLLLVQGLFVLGLFYMDWPTVGYGALLVWSF
FT YAYATEQCDKQGRMSGLKIQSMFGPVKTFAGRDKFHWYAVVNTGTSLDLLPESSDDELS
......
This diff is collapsed.
ID LT576316; SV 1; linear; genomic DNA; CON; FUN; 11202 BP.
ID LT576316; SV 1; linear; genomic DNA; STD; FUN; 11202 BP.
XX
AC LT576316;
XX
PR Project:PRJEB14097;
XX
DT 19-JUN-2016 (Rel. 129, Created)
DT 28-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
......@@ -14,13 +12,13 @@ XX
OS Yarrowia lipolytica
OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC Saccharomycetales; Dipodascaceae; Yarrowia.
OX NCBI_TaxID=4952
XX
RN [1]
RA Devillers H.;
RT ;
RL Submitted (20-MAY-2016) to the INSDC.
RL INRA UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850,
RL France
RL Submitted (20-MAY-2016) to the INSDC. INRA UMR 1319, Institut Micalis,
RL Bat. CBAI, Thiverval-Grignon, 78850, France
XX
DR MD5; 300fc5b224dd279fe94b56204d439663.
DR ENA; FLLM01000000; SET.
......@@ -30,18 +28,20 @@ XX
FH Key Location/Qualifiers
FH
FT source 1..11202
FT /organism="Yarrowia lipolytica"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:4952"
FT /mol_type="genomic DNA"
FT /organism="Yarrowia lipolytica"
FT gene 354..2123
FT /locus_tag="YALIA101_S20E00100G"
FT mRNA 354..2123
FT /locus_tag="YALIA101_S20E00100G"
FT /standard_name="YALIA101S20e00100g1"
FT /product="YALIA101S20e00100g1_1"
FT /standard_name="YALIA101S20e00100g1"
FT CDS 354..2123
FT /transl_table=1
FT /locus_tag="YALIA101_S20E00100G"
FT /standard_name="YALIA101S20e00100g1_1"
FT /protein_id="SEI37030.1"
FT /standard_name="YALIA101S20e00100g1_1"
FT /transl_table=1
FT /translation="MTLTNKLLHLVLCLLLAATICGASPVDLAARDFSDHQNELPSPSA
FT SDKYFNWTVDWTIQNPDGVFPRRVISINGEWPLPVINVTKGDRVVIDLYNDLGTQNVSL
FT HFHGLYQKGQNANDGPVWITQCPQTYHNQHTFMRYNFTVDQSGAYWYHSHVDGQYPDGL
......@@ -53,15 +53,17 @@ FT TYTHPKVPVLYTVLSSPNGLETNREIYGSNSNVFLLKHNEVVDVVINNQDDGEHPFHLH
FT GRNFQVPYRSPEYDDDNMTAFDPALKKDFSPIPMRRDTVYVRPNGNFVLRYRANNPGVW
FT FFHCHIEWHMSQGLALVMVEAPTEIKQKQTVPENHLQICQAGNVPTAGNAAANSRNWLD
FT LSNQNLQAPGLPH"
FT gene 3707..5080
FT /locus_tag="YALIA101_S20E00122G"
FT mRNA 3707..5080
FT /locus_tag="YALIA101_S20E00122G"
FT /standard_name="YALIA101S20e00122g1"
FT /product="YALIA101S20e00122g1_1"
FT /standard_name="YALIA101S20e00122g1"
FT CDS 3707..5080
FT /transl_table=1
FT /locus_tag="YALIA101_S20E00122G"
FT /standard_name="YALIA101S20e00122g1_1"
FT /protein_id="SEI37031.1"
FT /standard_name="YALIA101S20e00122g1_1"
FT /transl_table=1
FT /translation="MRKGLSSQHVDSHPNRTELELLFVPPERDSDDGFEIKYPYPDESP
FT YLETYDYPRPYAGTYPEFYAYPNDLSGENYPGYLGGNGYPYNLDTNGYVYLDDYPYRAS
FT GQLEGEIHVSTTVKPPSGFSTVYSPEHPRKAARLPLGIMDVHPPPVNRVLTPHHVAAWK
......@@ -74,13 +76,13 @@ FT gene 5999..7233
FT /locus_tag="YALIA101_S20E00144G"
FT mRNA join(5999..6317,6485..7233)
FT /locus_tag="YALIA101_S20E00144G"
FT /standard_name="YALIA101S20e00144g1"
FT /product="YALIA101S20e00144g1_1"
FT /standard_name="YALIA101S20e00144g1"
FT CDS join(5999..6317,6485..7233)
FT /transl_table=1
FT /locus_tag="YALIA101_S20E00144G"
FT /standard_name="YALIA101S20e00144g1_1"
FT /protein_id="SEI37032.1"
FT /standard_name="YALIA101S20e00144g1_1"
FT /transl_table=1
FT /translation="MGLRESQERSRNRESSRNREGNRLRDKQRGDLRERGERGERRERL
FT KSRDKERGRNRDREKDFSNKDARKERFRSITGKDWGRNVTTVDEGAQHYAIIKSPMAYI
FT PSSINFYAVSPDSTNRILFFKGVPAYVGVNDVVAQACGGPLEKVVVHPTMFGGTGEEAD
......
This diff is collapsed.
This diff is collapsed.
ID LT576319; SV 1; linear; genomic DNA; CON; FUN; 5503 BP.
ID LT576319; SV 1; linear; genomic DNA; STD; FUN; 5503 BP.
XX
AC LT576319;
XX
PR Project:PRJEB14097;
XX
DT 19-JUN-2016 (Rel. 129, Created)
DT 28-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
......@@ -14,13 +12,13 @@ XX
OS Yarrowia lipolytica
OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC Saccharomycetales; Dipodascaceae; Yarrowia.
OX NCBI_TaxID=4952
XX
RN [1]
RA Devillers H.;
RT ;
RL Submitted (20-MAY-2016) to the INSDC.
RL INRA UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850,
RL France
RL Submitted (20-MAY-2016) to the INSDC. INRA UMR 1319, Institut Micalis,
RL Bat. CBAI, Thiverval-Grignon, 78850, France
XX
DR MD5; 5bd90148b8a4de1d2cf87fdfa59e013b.
DR ENA; FLLM01000000; SET.
......@@ -30,14 +28,20 @@ XX
FH Key Location/Qualifiers
FH
FT source 1..5503
FT /organism="Yarrowia lipolytica"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:4952"
FT /mol_type="genomic DNA"
FT /organism="Yarrowia lipolytica"
FT gene 114..4634
FT /locus_tag="YALIA101_S28E00100G"
FT mRNA 114..4634
FT /locus_tag="YALIA101_S28E00100G"
FT /product="YALIA101S28e00100g1_1"
FT /standard_name="YALIA101S28e00100g1"
FT CDS 114..4634
FT /transl_table=1
FT /locus_tag="YALIA101_S28E00100G"
FT /standard_name="YALIA101S28e00100g1_1"
FT /protein_id="SEI37044.1"
FT /standard_name="YALIA101S28e00100g1_1"
FT /transl_table=1
FT /translation="MNSSDIMAAFQDEEPVDGLLKINEVQYEDLEGEDPGDTVPGTTIP
FT AYQRPVFVQRPDYAPLPDSSAADDMHYLKGERFFTADTELDSVICVRCRTCVPTSNLEG
FT HLRGVSHKVSLKKQSRIGAVVCTREELKDYCAKFSHCHNEKHIKSLPLAHPMLMEPVEG
......@@ -64,20 +68,18 @@ FT DADDAEVPLVAQHDGRWLDCQHRQAAIEASFESRASMSTWYSKLYSKYAHKLQNLCIPC
FT YFDGVKGCEYCDKAKRGAKAFFADYRQVMGSYKKKVAGSESFIYTGGPFAKYSCCFDCG
FT QPMQECTTTPSSNGKRKCNNRKYQGILFVLQWWKRRKNVANNRVHERFTKVMEEFCYKP
FT YKEFQEFDKKASDYYSYVVEPGNRYLKCTPWYFMAITLYALLEGE"
FT mRNA 114..4634
FT /locus_tag="YALIA101_S28E00100G"
FT /standard_name="YALIA101S28e00100g1"
FT /product="YALIA101S28e00100g1_1"
FT CDS complement(4662..5501)
FT /pseudo
FT /transl_table=1
FT gene complement(4662..5501)
FT /locus_tag="YALIA101_S28E00122G"
FT /standard_name="YALIA101S28e00122g1_1"
FT /db_xref="PSEUDO:SEI37045.1"
FT mRNA complement(4662..5501)
FT /locus_tag="YALIA101_S28E00122G"
FT /standard_name="YALIA101S28e00122g1"
FT /product="YALIA101S28e00122g1_1"
FT /standard_name="YALIA101S28e00122g1"
FT CDS complement(4662..5501)
FT /db_xref="PSEUDO:SEI37045.1"
FT /locus_tag="YALIA101_S28E00122G"
FT /pseudo
FT /standard_name="YALIA101S28e00122g1_1"
FT /transl_table=1
XX
SQ Sequence 5503 BP; 1324 A; 1362 C; 1508 G; 1309 T; 0 other;
cgccattctc tacaccagcc cctgcaacca gctcccacct atcgcccgtg tctacacctg 60
......
ID LT576320; SV 1; linear; genomic DNA; CON; FUN; 6986 BP.
ID LT576320; SV 1; linear; genomic DNA; STD; FUN; 6986 BP.
XX
AC LT576320;
XX
PR Project:PRJEB14097;
XX
DT 19-JUN-2016 (Rel. 129, Created)
DT 28-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
......@@ -14,13 +12,13 @@ XX
OS Yarrowia lipolytica
OC Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC Saccharomycetales; Dipodascaceae; Yarrowia.
OX NCBI_TaxID=4952
XX
RN [1]
RA Devillers H.;
RT ;
RL Submitted (20-MAY-2016) to the INSDC.
RL INRA UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850,
RL France
RL Submitted (20-MAY-2016) to the INSDC. INRA UMR 1319, Institut Micalis,
RL Bat. CBAI, Thiverval-Grignon, 78850, France
XX
DR MD5; 259f3e1e7fe59ca11c42cea169d2820c.
DR ENA; FLLM01000000; SET.
......@@ -30,18 +28,20 @@ XX
FH Key Location/Qualifiers
FH
FT source 1..6986
FT /organism="Yarrowia lipolytica"
FT /mol_type="genomic DNA"
FT /db_xref="taxon:4952"
FT /mol_type="genomic DNA"
FT /organism="Yarrowia lipolytica"
FT gene 1209..2639
FT /locus_tag="YALIA101_S27E00100G"
FT mRNA 1209..2639
FT /locus_tag="YALIA101_S27E00100G"
FT /standard_name="YALIA101S27e00100g1"
FT /product="YALIA101S27e00100g1_1"
FT /standard_name="YALIA101S27e00100g1"
FT CDS 1209..2639
FT /transl_table=1
FT /locus_tag="YALIA101_S27E00100G"
FT /standard_name="YALIA101S27e00100g1_1"
FT /protein_id="SEI37042.1"
FT /standard_name="YALIA101S27e00100g1_1"
FT /transl_table=1
FT /translation="MTTINSKALNGSFEGVPIGETIQWKNVLYADVKHRFAPPILKTDF